Lineage for d5ugyl2 (5ugy L:109-211)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2368769Domain d5ugyl2: 5ugy L:109-211 [329152]
    Other proteins in same PDB: d5ugya1, d5ugya2, d5ugyb_, d5ugyc1, d5ugyc2, d5ugyd_, d5ugye1, d5ugye2, d5ugyf_
    automated match to d4m5yl2
    complexed with bma, nag

Details for d5ugyl2

PDB Entry: 5ugy (more details), 2.8 Å

PDB Description: influenza hemagglutinin in complex with a neutralizing antibody
PDB Compounds: (L:) CH65 light chain

SCOPe Domain Sequences for d5ugyl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ugyl2 b.1.1.0 (L:109-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpsk
qsnnkyaassylsltpeqwkshrsyscqvthegstvektvapt

SCOPe Domain Coordinates for d5ugyl2:

Click to download the PDB-style file with coordinates for d5ugyl2.
(The format of our PDB-style files is described here.)

Timeline for d5ugyl2: