Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
Domain d5ugym2: 5ugy M:109-211 [329129] Other proteins in same PDB: d5ugya1, d5ugya2, d5ugyb_, d5ugyc1, d5ugyc2, d5ugyd_, d5ugye1, d5ugye2, d5ugyf_ automated match to d4m5yl2 complexed with bma, nag |
PDB Entry: 5ugy (more details), 2.8 Å
SCOPe Domain Sequences for d5ugym2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ugym2 b.1.1.0 (M:109-211) automated matches {Human (Homo sapiens) [TaxId: 9606]} gqpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpsk qsnnkyaassylsltpeqwkshrsyscqvthegstvektvapt
Timeline for d5ugym2: