Lineage for d5m2bm_ (5m2b M:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2599521Protein automated matches [190144] (14 species)
    not a true protein
  7. 2599790Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)
  8. 2600722Domain d5m2bm_: 5m2b M: [329027]
    Other proteins in same PDB: d5m2ba_, d5m2bc_, d5m2bd_, d5m2be_, d5m2bg_, d5m2bi_, d5m2bj_, d5m2bn_, d5m2bo_, d5m2bq_, d5m2br_, d5m2bs_, d5m2bu_, d5m2bw_, d5m2bx_
    automated match to d4qz7m_
    complexed with 7dx, cl, mg

Details for d5m2bm_

PDB Entry: 5m2b (more details), 2.7 Å

PDB Description: yeast 20s proteasome with human beta5i (1-138) and human beta6 (97- 111; 118-133) in complex with thiazole based inhibitor ro19
PDB Compounds: (M:) Proteasome subunit beta type-7

SCOPe Domain Sequences for d5m2bm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m2bm_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki

SCOPe Domain Coordinates for d5m2bm_:

Click to download the PDB-style file with coordinates for d5m2bm_.
(The format of our PDB-style files is described here.)

Timeline for d5m2bm_: