Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries) |
Domain d5m2bl_: 5m2b L: [328991] Other proteins in same PDB: d5m2ba_, d5m2bc_, d5m2bd_, d5m2be_, d5m2bg_, d5m2bi_, d5m2bj_, d5m2bn_, d5m2bo_, d5m2bq_, d5m2br_, d5m2bs_, d5m2bu_, d5m2bw_, d5m2bx_ automated match to d4j70l_ complexed with 7dx, cl, mg |
PDB Entry: 5m2b (more details), 2.7 Å
SCOPe Domain Sequences for d5m2bl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5m2bl_ d.153.1.4 (L:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad gdalvkrfknsvkwyhfdhndkklsinsaarniqhllysrrffpyyvyniiagldedgkg avysfdpvgsyqreqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd
Timeline for d5m2bl_: