SCOP 1.67: Domain d2gsrb2: 2gsr B:1-76

Lineage for d2gsrb2 (2gsr B:1-76)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (14 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)

6. Protein Class pi GST [81358] (3 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [52865] (1 PDB entry)

8. Domain d2gsrb2: 2gsr B:1-76 [32881]
   Other proteins in same PDB: d2gsra1, d2gsrb1
   complexed with ilg

Details for d2gsrb2

PDB Entry: 2gsr, 2.11 Å

PDB Description: structure of porcine class pi glutathione s-transferase

SCOP Domain Sequences for d2gsrb2:

Sequence; same for both SEQRES and ATOM records:

>d2gsrb2 c.47.1.5 (B:1-76) Class pi GST {Pig (Sus scrofa)}
ppytityfpvrgrceamrmlladqdqswkeevvtmetwpplkpsclfrqlpkfqdgdltl
yqsnailrhlgrsfgl

Timeline for d2gsrb2:

• d2gsrb2 first appeared (with stable ids) in SCOP 1.55
  
• d2gsrb2 appears in SCOP 1.65
  
• d2gsrb2 appears in SCOP 1.69
  
• d2gsrb2 appears in the current release, SCOPe 2.08