Lineage for d2gsrb2 (2gsr B:1-76)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24115Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 24116Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 24235Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins)
  6. 24236Protein Glutathione S-transferase [52863] (22 species)
  7. 24426Species Pig (Sus scrofa), class pi [52865] (1 PDB entry)
  8. 24428Domain d2gsrb2: 2gsr B:1-76 [32881]
    Other proteins in same PDB: d2gsra1, d2gsrb1

Details for d2gsrb2

PDB Entry: 2gsr (more details), 2.11 Å

PDB Description: structure of porcine class pi glutathione s-transferase

SCOP Domain Sequences for d2gsrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gsrb2 c.47.1.5 (B:1-76) Glutathione S-transferase {Pig (Sus scrofa), class pi}
ppytityfpvrgrceamrmlladqdqswkeevvtmetwpplkpsclfrqlpkfqdgdltl
yqsnailrhlgrsfgl

SCOP Domain Coordinates for d2gsrb2:

Click to download the PDB-style file with coordinates for d2gsrb2.
(The format of our PDB-style files is described here.)

Timeline for d2gsrb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gsrb1