SCOPe 2.08: Domain d2gsrb2: 2gsr B:1-76

Lineage for d2gsrb2 (2gsr B:1-76)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class pi GST [81358] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [52865] (1 PDB entry)

8. Domain d2gsrb2: 2gsr B:1-76 [32881]
   Other proteins in same PDB: d2gsra1, d2gsrb1
   complexed with gts

Details for d2gsrb2

PDB Entry: 2gsr, 2.11 Å

PDB Description: structure of porcine class pi glutathione s-transferase

PDB Compounds: (B:) class pi gst glutathione s-transferase

SCOPe Domain Sequences for d2gsrb2:

Sequence; same for both SEQRES and ATOM records:

>d2gsrb2 c.47.1.5 (B:1-76) Class pi GST {Pig (Sus scrofa) [TaxId: 9823]}
ppytityfpvrgrceamrmlladqdqswkeevvtmetwpplkpsclfrqlpkfqdgdltl
yqsnailrhlgrsfgl

Timeline for d2gsrb2:

• d2gsrb2 first appeared (with stable ids) in SCOP 1.55
  
• d2gsrb2 appears in SCOPe 2.07