Lineage for d2gsra2 (2gsr A:1-76)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2132062Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2132391Protein Class pi GST [81358] (4 species)
  7. 2132554Species Pig (Sus scrofa) [TaxId:9823] [52865] (1 PDB entry)
  8. 2132555Domain d2gsra2: 2gsr A:1-76 [32880]
    Other proteins in same PDB: d2gsra1, d2gsrb1
    complexed with gts

Details for d2gsra2

PDB Entry: 2gsr (more details), 2.11 Å

PDB Description: structure of porcine class pi glutathione s-transferase
PDB Compounds: (A:) class pi gst glutathione s-transferase

SCOPe Domain Sequences for d2gsra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gsra2 c.47.1.5 (A:1-76) Class pi GST {Pig (Sus scrofa) [TaxId: 9823]}
ppytityfpvrgrceamrmlladqdqswkeevvtmetwpplkpsclfrqlpkfqdgdltl
yqsnailrhlgrsfgl

SCOPe Domain Coordinates for d2gsra2:

Click to download the PDB-style file with coordinates for d2gsra2.
(The format of our PDB-style files is described here.)

Timeline for d2gsra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gsra1