Lineage for d5ue1b1 (5ue1 B:1-231)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140812Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2140829Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2140830Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2141593Protein automated matches [190142] (19 species)
    not a true protein
  7. 2141783Species Vibrio fischeri [TaxId:312309] [328771] (1 PDB entry)
  8. 2141785Domain d5ue1b1: 5ue1 B:1-231 [328787]
    Other proteins in same PDB: d5ue1a2, d5ue1b2
    automated match to d3dp9c_
    complexed with 9da, ca, cl, edo, trs

Details for d5ue1b1

PDB Entry: 5ue1 (more details), 1.14 Å

PDB Description: crystal structure of 5'-methylthioadenosine/s-adenosylhomocysteine nucleosidase in complex with adenine from vibrio fischeri es114
PDB Compounds: (B:) 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

SCOPe Domain Sequences for d5ue1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ue1b1 c.56.2.1 (B:1-231) automated matches {Vibrio fischeri [TaxId: 312309]}
mkigiigameqevailkdkieglstvtkagctfytgtlngadvvllqsgigkvaaavgtt
lliaehnvdvvlntgsaggfdsslnlgdvvistevrhhdadvtafgyemgqmaqqpaafi
adeklittaeqaltemsdkhavrglictgdvfvctperqefirthfpsviavemeasaia
qtchqfntpfvvvraisdvadkespmsfdeflplaaqsssemvlnmvtllk

SCOPe Domain Coordinates for d5ue1b1:

Click to download the PDB-style file with coordinates for d5ue1b1.
(The format of our PDB-style files is described here.)

Timeline for d5ue1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ue1b2