Lineage for d5lnvc_ (5lnv C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2090271Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2091023Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2091024Protein automated matches [190292] (34 species)
    not a true protein
  7. 2091028Species Arabidopsis thaliana [TaxId:3702] [323630] (8 PDB entries)
  8. 2091055Domain d5lnvc_: 5lnv C: [328668]
    automated match to d3fema_
    complexed with kik, po4, so4

Details for d5lnvc_

PDB Entry: 5lnv (more details), 2.24 Å

PDB Description: crystal structure of arabidopsis thaliana pdx1-i320 complex from multiple crystals
PDB Compounds: (C:) Pyridoxal 5'-phosphate synthase subunit PDX1.3

SCOPe Domain Sequences for d5lnvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lnvc_ c.1.2.0 (C:) automated matches {Arabidopsis thaliana [TaxId: 3702]}
spfsvkvglaqmlrggvimdvvnaeqariaeeagacavmalervpadiraqggvarmsdp
qmikeikqavtipvmakarighfveaqileaigidyidesevltladedhhinkhnfrip
fvcgcrnlgealrriregaamirtkgeagtgniieavrhvrsvngdirvlrnmdddevft
fakklaapydlvmqtkqlgrlpvvqfaaggvatpadaalmmqlgcdgvfvgsgifksgdp
arraraivqavthysdpemlvevscglgeamvginl

SCOPe Domain Coordinates for d5lnvc_:

Click to download the PDB-style file with coordinates for d5lnvc_.
(The format of our PDB-style files is described here.)

Timeline for d5lnvc_: