SCOPe 2.07: Domain d5jq6l2: 5jq6 L:113-216

Lineage for d5jq6l2 (5jq6 L:113-216)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d5jq6l2: 5jq6 L:113-216 [328617]
   automated match to d4m61a2

Details for d5jq6l2

PDB Entry: 5jq6, 2.4 Å

PDB Description: crystal structure of clfa in complex with the fab fragment of tefibazumab

PDB Compounds: (L:) Tefibazumab FAB FRAGMENT LIGHT CHAIN

SCOPe Domain Sequences for d5jq6l2:

Sequence, based on SEQRES records:

>d5jq6l2 b.1.1.0 (L:113-216) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksanr

Sequence, based on observed residues (ATOM records):

>d5jq6l2 b.1.1.0 (L:113-216) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvnalqsgnsqesvteqds
kdstyslsstltlskadyekhkvyacevthqgpvtksanr

Timeline for d5jq6l2:

• d5jq6l2 first appeared in SCOPe 2.06
  
• d5jq6l2 appears in the current release, SCOPe 2.08