Lineage for d5i2ub_ (5i2u B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2441004Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2441005Protein automated matches [190075] (125 species)
    not a true protein
  7. 2441803Species Soil metagenome [TaxId:410658] [328506] (1 PDB entry)
  8. 2441805Domain d5i2ub_: 5i2u B: [328507]
    automated match to d1qi2a_
    complexed with gol, mg, po4

Details for d5i2ub_

PDB Entry: 5i2u (more details), 2.2 Å

PDB Description: crystal structure of a novel halo-tolerant cellulase from soil metagenome
PDB Compounds: (B:) cellulase

SCOPe Domain Sequences for d5i2ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i2ub_ c.1.8.0 (B:) automated matches {Soil metagenome [TaxId: 410658]}
rsivaqngrlqvigtqlsnekgepvvlrgaslgwhnlwprfynknavqwladdwkctvvr
aamgleiednyrenpefalqcitpviesaiengiyviidfhahnkyteeaktffagmaek
ygeypnviyeiwnepdyfeweevktyseeviaviraidpdniilvgsphwdqdlhlvaed
pirdvsnimytmhfyaatheawlrdrtdeaiakgipvfvsecggseangdgrlgieewkt
yvdwmesrkiswvawsvsdknetcsmllprasadgnwtedllkpwgkltrnsirnan

SCOPe Domain Coordinates for d5i2ub_:

Click to download the PDB-style file with coordinates for d5i2ub_.
(The format of our PDB-style files is described here.)

Timeline for d5i2ub_: