SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5i2ub_ (5i2u B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (89 species)
    not a true protein
  7. 2285205Species Soil metagenome [TaxId:410658] [328506] (1 PDB entry)
  8. 2285206Domain d5i2ub_: 5i2u B: [328507]
    automated match to d1qi2a_
    complexed with gol, mg, po4

Details for d5i2ub_

PDB Entry: 5i2u (more details), 2.2 Å

PDB Description: crystal structure of a novel halo-tolerant cellulase from soil metagenome
PDB Compounds: (B:) cellulase

SCOPe Domain Sequences for d5i2ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i2ub_ c.1.8.0 (B:) automated matches {Soil metagenome [TaxId: 410658]}
rsivaqngrlqvigtqlsnekgepvvlrgaslgwhnlwprfynknavqwladdwkctvvr
aamgleiednyrenpefalqcitpviesaiengiyviidfhahnkyteeaktffagmaek
ygeypnviyeiwnepdyfeweevktyseeviaviraidpdniilvgsphwdqdlhlvaed
pirdvsnimytmhfyaatheawlrdrtdeaiakgipvfvsecggseangdgrlgieewkt
yvdwmesrkiswvawsvsdknetcsmllprasadgnwtedllkpwgkltrnsirnan

SCOPe Domain Coordinates for d5i2ub_:

Click to download the PDB-style file with coordinates for d5i2ub_.
(The format of our PDB-style files is described here.)

Timeline for d5i2ub_:

  • d5i2ub_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19