SCOPe 2.08: Domain d5i2ub_: 5i2u B:

Lineage for d5i2ub_ (5i2u B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (132 species)
   not a true protein

7. Species Soil metagenome [TaxId:410658] [328506] (1 PDB entry)

8. Domain d5i2ub_: 5i2u B: [328507]
   automated match to d1qi2a_
   complexed with gol, mg, po4

Details for d5i2ub_

PDB Entry: 5i2u, 2.2 Å

PDB Description: crystal structure of a novel halo-tolerant cellulase from soil metagenome

PDB Compounds: (B:) cellulase

SCOPe Domain Sequences for d5i2ub_:

Sequence; same for both SEQRES and ATOM records:

>d5i2ub_ c.1.8.0 (B:) automated matches {Soil metagenome [TaxId: 410658]}
rsivaqngrlqvigtqlsnekgepvvlrgaslgwhnlwprfynknavqwladdwkctvvr
aamgleiednyrenpefalqcitpviesaiengiyviidfhahnkyteeaktffagmaek
ygeypnviyeiwnepdyfeweevktyseeviaviraidpdniilvgsphwdqdlhlvaed
pirdvsnimytmhfyaatheawlrdrtdeaiakgipvfvsecggseangdgrlgieewkt
yvdwmesrkiswvawsvsdknetcsmllprasadgnwtedllkpwgkltrnsirnan

Timeline for d5i2ub_:

• d5i2ub_ first appeared in SCOPe 2.06
  
• d5i2ub_ appears in SCOPe 2.07