Lineage for d5hhuk_ (5hhu K:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143900Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2143901Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2143902Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2144285Protein automated matches [190074] (13 species)
    not a true protein
  7. 2144324Species Plasmodium vivax [TaxId:5855] [328484] (2 PDB entries)
  8. 2144347Domain d5hhuk_: 5hhu K: [328485]
    Other proteins in same PDB: d5hhua2, d5hhub2, d5hhuc2, d5hhuf2
    automated match to d1cjba_
    complexed with mg, ypg

Details for d5hhuk_

PDB Entry: 5hhu (more details), 3.05 Å

PDB Description: plasmodium vivax hypoxanthine-guanine phosphoribosyltransferase in complex with [3r,4r]-4-guanin-9-yl-3-((s)-2-hydroxy-2- phosphonoethyl)oxy-1-n-(phosphonopropionyl)pyrrolidine
PDB Compounds: (K:) hypoxanthine-guanine-xanthine phosphoribosyltransferase

SCOPe Domain Sequences for d5hhuk_:

Sequence, based on SEQRES records: (download)

>d5hhuk_ c.61.1.1 (K:) automated matches {Plasmodium vivax [TaxId: 5855]}
kipnnpgagenalepiyikdddgydidtflipdhyknyitkvlipngvlknrieklafdi
kqvyrneefhvicllkgsrgffsallkylnrihnysstespkhlyvehyvrvksycndqs
ldrieivsedlsclkdkhvlivediidtgktllkfceylkkfevktiaitclfikrtplw
ngfkadfvgfsipdafvvgysldynekfrdldhlclvndegikkfrt

Sequence, based on observed residues (ATOM records): (download)

>d5hhuk_ c.61.1.1 (K:) automated matches {Plasmodium vivax [TaxId: 5855]}
kipnnpgagenalepiyikdddgydidtflipdhyknyitkvlipngvlknrieklafdi
kqvyrneefhvicllkgsrgffsallkylnrihnysstespkhlyvehyvrvkieivsed
lsclkdkhvlivediidtgktllkfceylkkfevktiaitclfikrtplwngfkadfvgf
sipdafvvgysldynekfrdldhlclvndegikkfrt

SCOPe Domain Coordinates for d5hhuk_:

Click to download the PDB-style file with coordinates for d5hhuk_.
(The format of our PDB-style files is described here.)

Timeline for d5hhuk_:

  • d5hhuk_ is new in SCOPe 2.06-stable
  • d5hhuk_ does not appear in SCOPe 2.07