Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (121 species) not a true protein |
Species Campylobacter jejuni [TaxId:197] [189298] (7 PDB entries) |
Domain d5u1za1: 5u1z A:1-360 [328351] Other proteins in same PDB: d5u1za2, d5u1zb2, d5u1zc2 automated match to d2ogea_ complexed with cl, na |
PDB Entry: 5u1z (more details), 1.6 Å
SCOPe Domain Sequences for d5u1za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u1za1 c.67.1.0 (A:1-360) automated matches {Campylobacter jejuni [TaxId: 197]} mfflnlkqindrfntefitkfkeilesgwyilgkqcekfennfakycgvkhcigvangld alrliikaydfkendeiivpantyiasilaitdnkckpiliepdintyninpdlieekit kktkaimvvhlygqvcdmekiqllankynlkiiedcaqahgaiykdkrvgnlgdaagfsf ypgknlgalgdagcictnddnfaskiralanygshkkyenlytglnsrldeiqaafldik lkyldednnkrknianfylqnikneniilpsnkfdhvwhlfvvktklrdelqhylnnhdi qtiihypipphkqkcykdlnhlklpitenihqevlslpisptmkendfkkvadilnkwkv
Timeline for d5u1za1: