Lineage for d5fhva1 (5fhv A:7-224)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546826Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2546827Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2547682Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2547683Protein automated matches [190526] (25 species)
    not a true protein
  7. 2547797Species Coral (Discosoma sp.) [TaxId:86600] [258320] (5 PDB entries)
  8. 2547802Domain d5fhva1: 5fhv A:7-224 [327987]
    Other proteins in same PDB: d5fhva2, d5fhva3
    automated match to d3st2a_
    complexed with bme, p6g, pge

Details for d5fhva1

PDB Entry: 5fhv (more details), 1.55 Å

PDB Description: crystal structure of mcherry after reaction with 2-mercaptoethanol
PDB Compounds: (A:) mCherry-BME

SCOPe Domain Sequences for d5fhva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fhva1 d.22.1.0 (A:7-224) automated matches {Coral (Discosoma sp.) [TaxId: 86600]}
iikefmrfkvhmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilspqfm
ygxskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvklr
gtnfpsdgpvmqkktmgweassermypedgalkgeikqrlklkdgghydaevkttykakk
pvqlpgaynvniklditshnedytiveqyeraegrhstg

SCOPe Domain Coordinates for d5fhva1:

Click to download the PDB-style file with coordinates for d5fhva1.
(The format of our PDB-style files is described here.)

Timeline for d5fhva1: