Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
Protein automated matches [190526] (25 species) not a true protein |
Species Coral (Discosoma sp.) [TaxId:86600] [258320] (5 PDB entries) |
Domain d5fhva1: 5fhv A:7-224 [327987] Other proteins in same PDB: d5fhva2, d5fhva3 automated match to d3st2a_ complexed with bme, p6g, pge |
PDB Entry: 5fhv (more details), 1.55 Å
SCOPe Domain Sequences for d5fhva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fhva1 d.22.1.0 (A:7-224) automated matches {Coral (Discosoma sp.) [TaxId: 86600]} iikefmrfkvhmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilspqfm ygxskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvklr gtnfpsdgpvmqkktmgweassermypedgalkgeikqrlklkdgghydaevkttykakk pvqlpgaynvniklditshnedytiveqyeraegrhstg
Timeline for d5fhva1: