SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5fhva1 (5fhv A:7-224)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164731Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2164732Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2165335Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2165336Protein automated matches [190526] (21 species)
    not a true protein
  7. 2165400Species Coral (Discosoma sp.) [TaxId:86600] [258320] (4 PDB entries)
  8. 2284686Domain d5fhva1: 5fhv A:7-224 [327987]
    Other proteins in same PDB: d5fhva2, d5fhva3
    automated match to d3st2a_
    complexed with bme, p6g, pge

Details for d5fhva1

PDB Entry: 5fhv (more details), 1.55 Å

PDB Description: crystal structure of mcherry after reaction with 2-mercaptoethanol
PDB Compounds: (A:) mCherry-BME

SCOPe Domain Sequences for d5fhva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fhva1 d.22.1.0 (A:7-224) automated matches {Coral (Discosoma sp.) [TaxId: 86600]}
iikefmrfkvhmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilspqfm
ygxskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykvklr
gtnfpsdgpvmqkktmgweassermypedgalkgeikqrlklkdgghydaevkttykakk
pvqlpgaynvniklditshnedytiveqyeraegrhstg

SCOPe Domain Coordinates for d5fhva1:

Click to download the PDB-style file with coordinates for d5fhva1.
(The format of our PDB-style files is described here.)

Timeline for d5fhva1:

  • d5fhva1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-12