SCOPe 2.07: Domain d5t6nf_: 5t6n F:

Lineage for d5t6nf_ (5t6n F:)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (17 species)
   trimer

7. Species Influenza A virus (strain a/northern territory/60/1968 h3n2) [TaxId:384505] [327816] (3 PDB entries)

8. Domain d5t6nf_: 5t6n F: [327817]
   Other proteins in same PDB: d5t6na1, d5t6na2, d5t6nc1, d5t6nc2, d5t6ne1, d5t6ne2
   automated match to d1qfub_
   complexed with 75u, bma, gol, man, nag, so4

Details for d5t6nf_

PDB Entry: 5t6n, 2.54 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin in complex with the antiviral drug arbidol

PDB Compounds: (F:) hemagglutinin HA2

SCOPe Domain Sequences for d5t6nf_:

Sequence; same for both SEQRES and ATOM records:

>d5t6nf_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus (strain a/northern territory/60/1968 h3n2) [TaxId: 384505]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrf

Timeline for d5t6nf_:

• d5t6nf_ first appeared in SCOPe 2.06
  
• d5t6nf_ appears in the current release, SCOPe 2.08