Lineage for d5t6nf_ (5t6n F:)

  1. Root: SCOPe 2.06
  2. 2237529Class h: Coiled coil proteins [57942] (7 folds)
  3. 2238933Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2238934Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2238935Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 protein domains)
  6. 2238936Protein Influenza hemagglutinin (stalk) [58066] (12 species)
    trimer
  7. 2284515Species Influenza a virus (strain a/northern territory/60/1968 h3n2) [TaxId:384505] [327816] (1 PDB entry)
  8. 2284516Domain d5t6nf_: 5t6n F: [327817]
    Other proteins in same PDB: d5t6na1, d5t6na2, d5t6nc1, d5t6nc2, d5t6ne1, d5t6ne2
    automated match to d1qfub_
    complexed with 75u, bma, gol, man, nag, so4

Details for d5t6nf_

PDB Entry: 5t6n (more details), 2.54 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin in complex with the antiviral drug arbidol
PDB Compounds: (F:) hemagglutinin HA2

SCOPe Domain Sequences for d5t6nf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t6nf_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza a virus (strain a/northern territory/60/1968 h3n2) [TaxId: 384505]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrf

SCOPe Domain Coordinates for d5t6nf_:

Click to download the PDB-style file with coordinates for d5t6nf_.
(The format of our PDB-style files is described here.)

Timeline for d5t6nf_:

  • d5t6nf_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-04