SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t6nf_ (5t6n F:)

  1. Root: SCOPe 2.06
  2. 2237529Class h: Coiled coil proteins [57942] (7 folds)
  3. 2238933Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2238934Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2238935Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 protein domains)
  6. 2238936Protein Influenza hemagglutinin (stalk) [58066] (11 species)
    trimer
  7. 2284515Species Influenza a virus (strain a/northern territory/60/1968 h3n2) [TaxId:384505] [327816] (1 PDB entry)
  8. 2284516Domain d5t6nf_: 5t6n F: [327817]
    Other proteins in same PDB: d5t6na1, d5t6na2, d5t6nc1, d5t6nc2, d5t6ne1, d5t6ne2
    automated match to d1qfub_
    complexed with 75u, bma, gol, man, nag, so4

Details for d5t6nf_

PDB Entry: 5t6n (more details), 2.54 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin in complex with the antiviral drug arbidol
PDB Compounds: (F:) hemagglutinin HA2

SCOPe Domain Sequences for d5t6nf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t6nf_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza a virus (strain a/northern territory/60/1968 h3n2) [TaxId: 384505]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrf

SCOPe Domain Coordinates for d5t6nf_:

Click to download the PDB-style file with coordinates for d5t6nf_.
(The format of our PDB-style files is described here.)

Timeline for d5t6nf_:

  • d5t6nf_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-04