Lineage for d5h9hb_ (5h9h B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993360Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1993361Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 1993481Family a.28.1.0: automated matches [191582] (1 protein)
    not a true family
  6. 1993482Protein automated matches [191038] (20 species)
    not a true protein
  7. 1993504Species Helicobacter pylori [TaxId:570508] [327571] (2 PDB entries)
  8. 1993506Domain d5h9hb_: 5h9h B: [327572]
    automated match to d3gzmb_

Details for d5h9hb_

PDB Entry: 5h9h (more details), 2.5 Å

PDB Description: holo acyl carrier protein (holo-acp) from helicobacter pylori
PDB Compounds: (B:) Acyl carrier protein

SCOPe Domain Sequences for d5h9hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h9hb_ a.28.1.0 (B:) automated matches {Helicobacter pylori [TaxId: 570508]}
alfediqaviaeqlnvdaaqvtpeaefvkdlgadxldvvelimaleekfgieipdeqaek
ivnvgdvvkyiednk

SCOPe Domain Coordinates for d5h9hb_:

Click to download the PDB-style file with coordinates for d5h9hb_.
(The format of our PDB-style files is described here.)

Timeline for d5h9hb_: