Class a: All alpha proteins [46456] (289 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) |
Family a.28.1.0: automated matches [191582] (1 protein) not a true family |
Protein automated matches [191038] (20 species) not a true protein |
Species Helicobacter pylori [TaxId:570508] [327571] (2 PDB entries) |
Domain d5h9hb_: 5h9h B: [327572] automated match to d3gzmb_ |
PDB Entry: 5h9h (more details), 2.5 Å
SCOPe Domain Sequences for d5h9hb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h9hb_ a.28.1.0 (B:) automated matches {Helicobacter pylori [TaxId: 570508]} alfediqaviaeqlnvdaaqvtpeaefvkdlgadxldvvelimaleekfgieipdeqaek ivnvgdvvkyiednk
Timeline for d5h9hb_: