Lineage for d5ffza1 (5ffz A:2-139)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983660Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1983661Protein automated matches [190154] (66 species)
    not a true protein
  7. 1983986Species Staphylococcus aureus [TaxId:1280] [193082] (9 PDB entries)
  8. 2284015Domain d5ffza1: 5ffz A:2-139 [327316]
    Other proteins in same PDB: d5ffza2
    automated match to d4llla_
    protein/DNA complex; complexed with et, k

Details for d5ffza1

PDB Entry: 5ffz (more details), 2.59 Å

PDB Description: s. aureus mepr bound to ethidium bromide
PDB Compounds: (A:) MarR family regulatory protein

SCOPe Domain Sequences for d5ffza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ffza1 a.4.5.0 (A:2-139) automated matches {Staphylococcus aureus [TaxId: 1280]}
eftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtg
ptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqlse
eeneqmkanltkmlsslq

SCOPe Domain Coordinates for d5ffza1:

Click to download the PDB-style file with coordinates for d5ffza1.
(The format of our PDB-style files is described here.)

Timeline for d5ffza1:

  • d5ffza1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-22

View in 3D
Domains from same chain:
(mouse over for more information)
d5ffza2