Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (92 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [193082] (9 PDB entries) |
Domain d5ffza1: 5ffz A:2-139 [327316] Other proteins in same PDB: d5ffza2 automated match to d4llla_ protein/DNA complex; complexed with et, k |
PDB Entry: 5ffz (more details), 2.59 Å
SCOPe Domain Sequences for d5ffza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ffza1 a.4.5.0 (A:2-139) automated matches {Staphylococcus aureus [TaxId: 1280]} eftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtg ptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqlse eeneqmkanltkmlsslq
Timeline for d5ffza1: