Lineage for d5f9kb1 (5f9k B:5-130)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2427208Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2427417Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2427616Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 2427617Protein automated matches [191182] (19 species)
    not a true protein
  7. 2427811Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [327115] (1 PDB entry)
  8. 2427813Domain d5f9kb1: 5f9k B:5-130 [327116]
    Other proteins in same PDB: d5f9ka2, d5f9kb2, d5f9kc2
    automated match to d4oopb_
    complexed with dup, mg, so4

Details for d5f9kb1

PDB Entry: 5f9k (more details), 2.18 Å

PDB Description: dictyostelium discoideum dutpase at 2.2 angstrom
PDB Compounds: (B:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d5f9kb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f9kb1 b.85.4.0 (B:5-130) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
fkvkklsdkaiipqrgskgaagydlssahelvvpahgkalamtdlqiaipdgtygriapr
sglawknfidcgagvidsdyrgnvgvvlfnhsdvdfkvavgdrvaqliferivtpeplev
deidet

SCOPe Domain Coordinates for d5f9kb1:

Click to download the PDB-style file with coordinates for d5f9kb1.
(The format of our PDB-style files is described here.)

Timeline for d5f9kb1: