SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5f9kb1 (5f9k B:5-130)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2072411Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2072562Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2072756Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 2072757Protein automated matches [191182] (14 species)
    not a true protein
  7. 2283814Species Dictyostelium discoideum [TaxId:44689] [327115] (1 PDB entry)
  8. 2283815Domain d5f9kb1: 5f9k B:5-130 [327116]
    Other proteins in same PDB: d5f9ka2, d5f9kb2, d5f9kc2
    automated match to d4oopb_
    complexed with dup, mg, so4

Details for d5f9kb1

PDB Entry: 5f9k (more details), 2.18 Å

PDB Description: dictyostelium discoideum dutpase at 2.2 angstrom
PDB Compounds: (B:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d5f9kb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f9kb1 b.85.4.0 (B:5-130) automated matches {Dictyostelium discoideum [TaxId: 44689]}
fkvkklsdkaiipqrgskgaagydlssahelvvpahgkalamtdlqiaipdgtygriapr
sglawknfidcgagvidsdyrgnvgvvlfnhsdvdfkvavgdrvaqliferivtpeplev
deidet

SCOPe Domain Coordinates for d5f9kb1:

Click to download the PDB-style file with coordinates for d5f9kb1.
(The format of our PDB-style files is described here.)

Timeline for d5f9kb1:

  • d5f9kb1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-15