SCOPe 2.07: Domain d5laxc2: 5lax C:82-180

Lineage for d5laxc2 (5lax C:82-180)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d5laxc2: 5lax C:82-180 [327079]
   Other proteins in same PDB: d5laxa1, d5laxa3, d5laxb1, d5laxb2, d5laxb3, d5laxc1, d5laxd1, d5laxd2, d5laxd3
   automated match to d1ieaa1
   complexed with mla

Details for d5laxc2

PDB Entry: 5lax, 2.6 Å

PDB Description: crystal structure of hla_drb1*04:01 in complex with alpha-enolase peptide 26-40

PDB Compounds: (C:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d5laxc2:

Sequence; same for both SEQRES and ATOM records:

>d5laxc2 b.1.1.0 (C:82-180) automated matches {Human (Homo sapiens) [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwef

Timeline for d5laxc2:

• d5laxc2 first appeared in SCOPe 2.06
  
• d5laxc2 appears in the current release, SCOPe 2.08