SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5laxc2 (5lax C:82-180)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (25 species)
    not a true protein
  7. 2026747Species Human (Homo sapiens) [TaxId:9606] [187920] (831 PDB entries)
  8. 2283778Domain d5laxc2: 5lax C:82-180 [327079]
    Other proteins in same PDB: d5laxa1, d5laxa3, d5laxb1, d5laxb2, d5laxb3, d5laxc1, d5laxd1, d5laxd2, d5laxd3
    automated match to d1ieaa1
    complexed with mla

Details for d5laxc2

PDB Entry: 5lax (more details), 2.6 Å

PDB Description: crystal structure of hla_drb1*04:01 in complex with alpha-enolase peptide 26-40
PDB Compounds: (C:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d5laxc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5laxc2 b.1.1.0 (C:82-180) automated matches {Human (Homo sapiens) [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwef

SCOPe Domain Coordinates for d5laxc2:

Click to download the PDB-style file with coordinates for d5laxc2.
(The format of our PDB-style files is described here.)

Timeline for d5laxc2:

  • d5laxc2 appears in periodic updates to SCOPe 2.06 starting on 2016-12-08