Lineage for d5b1hc_ (5b1h C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2156898Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2156899Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2157251Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2157252Protein automated matches [190215] (33 species)
    not a true protein
  7. 2157318Species Lactobacillus plantarum [TaxId:220668] [326845] (1 PDB entry)
  8. 2157321Domain d5b1hc_: 5b1h C: [326873]
    automated match to d4lmaa_
    complexed with gol, so4

Details for d5b1hc_

PDB Entry: 5b1h (more details), 2.4 Å

PDB Description: crystal structure of cystathionine beta-synthase from lactobacillus plantarum
PDB Compounds: (C:) cystathionine beta-synthase

SCOPe Domain Sequences for d5b1hc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b1hc_ c.79.1.0 (C:) automated matches {Lactobacillus plantarum [TaxId: 220668]}
mliqhvqelightplmalpievpnhshiyaklemfnpggsikdrlgayliedglqrgrvn
akttiieptagntgiglalatqahhlrtilvvpekfsmekqvlmqalgaeivhtpseegi
kgairkaealaatisnsyvpmqfknpanpaayyhtlapeiladmpapitafvagagsggt
fagvaaylqaqdsatkavvvepegsilnggpahahrtegigvefippffdqvridqtlti
adndafaqvrhlardhglligsssgaalaaslqlatnlpanshivtifpdsserylsqki
ytk

SCOPe Domain Coordinates for d5b1hc_:

Click to download the PDB-style file with coordinates for d5b1hc_.
(The format of our PDB-style files is described here.)

Timeline for d5b1hc_: