Lineage for d5h4zb_ (5h4z B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2382505Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2382506Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2382773Family b.7.1.0: automated matches [191388] (1 protein)
    not a true family
  6. 2382774Protein automated matches [190497] (4 species)
    not a true protein
  7. 2382777Species Human (Homo sapiens) [TaxId:9606] [188711] (25 PDB entries)
  8. 2382808Domain d5h4zb_: 5h4z B: [326692]
    automated match to d1w15a_
    complexed with ca, cl; mutant

Details for d5h4zb_

PDB Entry: 5h4z (more details), 3.01 Å

PDB Description: crystal structure of s202g mutant of human syt-5 c2a domain
PDB Compounds: (B:) Synaptotagmin-5

SCOPe Domain Sequences for d5h4zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h4zb_ b.7.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
khelgqlqysldydfqsgqllvgilqamglaaldlggssdpyvrvyllpdkrrryetkvh
rqtlnphfgetfafkvpyvelggrvlvmavydfdrfgrndaigevrvpmssvdlgrpvqa
wrelqaap

SCOPe Domain Coordinates for d5h4zb_:

Click to download the PDB-style file with coordinates for d5h4zb_.
(The format of our PDB-style files is described here.)

Timeline for d5h4zb_: