Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) |
Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins) duplication: consists of two domains of this fold |
Protein UL44 [111176] (2 species) |
Species Human cytomegalovirus (strain ad169) [TaxId:10360] [326638] (2 PDB entries) |
Domain d5iwda1: 5iwd A:3-135 [326655] automated match to d1yypa1 protein/DNA complex; complexed with 6ev |
PDB Entry: 5iwd (more details), 2.56 Å
SCOPe Domain Sequences for d5iwda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5iwda1 d.131.1.2 (A:3-135) UL44 {Human cytomegalovirus (strain ad169) [TaxId: 10360]} rkdrlsepptlalrlkpyktaiqqlrsviralkenttvtflptpslilqtvrshcvskit fnssclyitdksfqpktinnstpllgnfmyltsskdltkfyvqdisdlsakismcapdfn mefssacvhgqdi
Timeline for d5iwda1: