Lineage for d5iwda1 (5iwd A:3-135)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976821Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2976822Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2977007Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 2977186Protein UL44 [111176] (2 species)
  7. 2977187Species Human cytomegalovirus (strain ad169) [TaxId:10360] [326638] (2 PDB entries)
  8. 2977188Domain d5iwda1: 5iwd A:3-135 [326655]
    automated match to d1yypa1
    protein/DNA complex; complexed with 6ev

Details for d5iwda1

PDB Entry: 5iwd (more details), 2.56 Å

PDB Description: hcmv dna polymerase subunit ul44 complex with a small molecule
PDB Compounds: (A:) DNA polymerase processivity factor

SCOPe Domain Sequences for d5iwda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iwda1 d.131.1.2 (A:3-135) UL44 {Human cytomegalovirus (strain ad169) [TaxId: 10360]}
rkdrlsepptlalrlkpyktaiqqlrsviralkenttvtflptpslilqtvrshcvskit
fnssclyitdksfqpktinnstpllgnfmyltsskdltkfyvqdisdlsakismcapdfn
mefssacvhgqdi

SCOPe Domain Coordinates for d5iwda1:

Click to download the PDB-style file with coordinates for d5iwda1.
(The format of our PDB-style files is described here.)

Timeline for d5iwda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5iwda2