SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5eqta_ (5eqt A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (123 species)
    not a true protein
  7. 2283156Species Pyrococcus horikoshii [TaxId:53953] [326457] (1 PDB entry)
  8. 2283157Domain d5eqta_: 5eqt A: [326458]
    automated match to d3h4ma_
    complexed with act, adp, so4

Details for d5eqta_

PDB Entry: 5eqt (more details), 1.94 Å

PDB Description: crystal structure of the atpase domain of pan from pyrococcus horikoshii
PDB Compounds: (A:) Proteasome-activating nucleotidase

SCOPe Domain Sequences for d5eqta_:

Sequence, based on SEQRES records: (download)

>d5eqta_ c.37.1.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
nvtyndigglkkqlqelreaielplkhpelfeevgidppkgvllygppgcgktlmakala
hevnatfirvvgselvrkyigegarlvhelfelakekaptiifideidaigakrmdettg
gerevnrtlmqllaemdgfdprgnvkviaatnrpdildpallrpgrfdrlievplpdfeg
rleilkvhtrrmklkgvdlraiaemtegasgadlkaiateagmfairerrtyvtqedflk
avdkvlgnerkllqqit

Sequence, based on observed residues (ATOM records): (download)

>d5eqta_ c.37.1.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
nvtyndigglkkqlqelreaielplkhpelfeevgidppkgvllygppgcgktlmakala
hevnatfirvvgselvrkyigegarlvhelfelakekaptiifideidaigakerevnrt
lmqllaemdgfdprgnvkviaatnrpdildpallrpgrfdrlievplpdfegrleilkvh
trrmklkgvdlraiaemtegasgadlkaiateagmfairerrtyvtqedflkavdkvlgn
erkllqqit

SCOPe Domain Coordinates for d5eqta_:

Click to download the PDB-style file with coordinates for d5eqta_.
(The format of our PDB-style files is described here.)

Timeline for d5eqta_:

  • d5eqta_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-23