Lineage for d5eqta_ (5eqt A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2283156Species Pyrococcus horikoshii [TaxId:53953] [326457] (1 PDB entry)
  8. 2283157Domain d5eqta_: 5eqt A: [326458]
    automated match to d3h4ma_
    complexed with act, adp, so4

Details for d5eqta_

PDB Entry: 5eqt (more details), 1.94 Å

PDB Description: crystal structure of the atpase domain of pan from pyrococcus horikoshii
PDB Compounds: (A:) Proteasome-activating nucleotidase

SCOPe Domain Sequences for d5eqta_:

Sequence, based on SEQRES records: (download)

>d5eqta_ c.37.1.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
nvtyndigglkkqlqelreaielplkhpelfeevgidppkgvllygppgcgktlmakala
hevnatfirvvgselvrkyigegarlvhelfelakekaptiifideidaigakrmdettg
gerevnrtlmqllaemdgfdprgnvkviaatnrpdildpallrpgrfdrlievplpdfeg
rleilkvhtrrmklkgvdlraiaemtegasgadlkaiateagmfairerrtyvtqedflk
avdkvlgnerkllqqit

Sequence, based on observed residues (ATOM records): (download)

>d5eqta_ c.37.1.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
nvtyndigglkkqlqelreaielplkhpelfeevgidppkgvllygppgcgktlmakala
hevnatfirvvgselvrkyigegarlvhelfelakekaptiifideidaigakerevnrt
lmqllaemdgfdprgnvkviaatnrpdildpallrpgrfdrlievplpdfegrleilkvh
trrmklkgvdlraiaemtegasgadlkaiateagmfairerrtyvtqedflkavdkvlgn
erkllqqit

SCOPe Domain Coordinates for d5eqta_:

Click to download the PDB-style file with coordinates for d5eqta_.
(The format of our PDB-style files is described here.)

Timeline for d5eqta_:

  • d5eqta_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-23