Lineage for d5epub_ (5epu B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2495644Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2495645Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2496076Protein Uridine phosphorylase [53176] (6 species)
  7. 2496318Species Vibrio cholerae [TaxId:243277] [224899] (19 PDB entries)
  8. 2496338Domain d5epub_: 5epu B: [326450]
    automated match to d5efob_
    complexed with cl, cyt, edo, gol, mg, na, trs

Details for d5epub_

PDB Entry: 5epu (more details), 1.06 Å

PDB Description: x-ray structure uridine phosphorylase from vibrio cholerae in complex with cytosine at 1.06a.
PDB Compounds: (B:) Uridine phosphorylase

SCOPe Domain Sequences for d5epub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5epub_ c.56.2.1 (B:) Uridine phosphorylase {Vibrio cholerae [TaxId: 243277]}
tktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsv
vvcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslh
fapmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqg
smkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketearsi
kvvveaarkmlk

SCOPe Domain Coordinates for d5epub_:

Click to download the PDB-style file with coordinates for d5epub_.
(The format of our PDB-style files is described here.)

Timeline for d5epub_: