SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5h4gb_ (5h4g B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150569Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 2150570Superfamily c.120.1: PIN domain-like [88723] (3 families) (S)
  5. 2150571Family c.120.1.1: PIN domain [89619] (7 protein domains)
    Pfam PF01850
  6. 2150609Protein Hypothetical protein PH0500 [142112] (2 species)
  7. 2283122Species Pyrococcus horikoshii [TaxId:70601] [326423] (2 PDB entries)
  8. 2283139Domain d5h4gb_: 5h4g B: [326440]
    automated match to d1v96a1
    complexed with zn

Details for d5h4gb_

PDB Entry: 5h4g (more details), 1.77 Å

PDB Description: structure of pin-domain protein (vapc4 toxin) from pyrococcus horikoshii determined at 1.77 a resolution
PDB Compounds: (B:) Ribonuclease VapC4

SCOPe Domain Sequences for d5h4gb_:

Sequence, based on SEQRES records: (download)

>d5h4gb_ c.120.1.1 (B:) Hypothetical protein PH0500 {Pyrococcus horikoshii [TaxId: 70601]}
plppditfdslalikmhsqnmkrilevtlakftvnlsivtvyryltaraylkknieaefe
ilkdiynivpllddiaikaaqieanlikkeitldmediitattaiytnsllvtddpkrye
pirrfgldtmpldkfikevelmvek

Sequence, based on observed residues (ATOM records): (download)

>d5h4gb_ c.120.1.1 (B:) Hypothetical protein PH0500 {Pyrococcus horikoshii [TaxId: 70601]}
plppditfdslalikmhsqnmkrilevtlakftvnlsivtvyryltaraylkknieaefe
ilkdiynivpllddiaikaaqieanlldmediitattaiytnsllvtddpkryepirrfg
ldtmpldkfikevelmvek

SCOPe Domain Coordinates for d5h4gb_:

Click to download the PDB-style file with coordinates for d5h4gb_.
(The format of our PDB-style files is described here.)

Timeline for d5h4gb_:

  • d5h4gb_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-23