SCOPe 2.07: Domain d5tqia1: 5tqi A:1-286

Lineage for d5tqia1 (5tqi A:1-286)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.0: automated matches [191321] (1 protein)
   not a true family

6. Protein automated matches [190117] (50 species)
   not a true protein

7. Species Burkholderia multivorans [TaxId:395019] [326309] (1 PDB entry)

8. Domain d5tqia1: 5tqi A:1-286 [326353]
   Other proteins in same PDB: d5tqia2, d5tqib2
   automated match to d3pzsb_
   complexed with cl

Details for d5tqia1

PDB Entry: 5tqi, 1.5 Å

PDB Description: crystal structure of a pyridoxal kinase from burkholderia multivorans

PDB Compounds: (A:) Pyridoxal kinase PdxY

SCOPe Domain Sequences for d5tqia1:

Sequence; same for both SEQRES and ATOM records:

>d5tqia1 c.72.1.0 (A:1-286) automated matches {Burkholderia multivorans [TaxId: 395019]}
mknvlsiqshviyghagnsaavfpmqrlgvnvwplntvqlsnhmqyghwagsaidaakme
qlvdgiaaigalkrcdavlsgfagspaqaratveivravkamnpnawyfcdpamgqtggi
rpepgveefivnempaladgmspnhtelqklagrrietvaeavdacrtliargpkiilvk
hlhdrnspadrfnmlavteteawigqrplyafprhpvgvgdltsaifvarrlrgdsvraa
fehtlaavhavvkatydarryeleliaaqdeiarpsewfgawvtdv

Timeline for d5tqia1:

• d5tqia1 first appeared in SCOPe 2.06
  
• d5tqia1 appears in the current release, SCOPe 2.08