SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tqia1 (5tqi A:1-286)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2137472Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2137707Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2137708Protein automated matches [190117] (40 species)
    not a true protein
  7. 2283008Species Burkholderia multivorans [TaxId:395019] [326309] (1 PDB entry)
  8. 2283052Domain d5tqia1: 5tqi A:1-286 [326353]
    Other proteins in same PDB: d5tqia2, d5tqib2
    automated match to d3pzsb_
    complexed with cl

Details for d5tqia1

PDB Entry: 5tqi (more details), 1.5 Å

PDB Description: crystal structure of a pyridoxal kinase from burkholderia multivorans
PDB Compounds: (A:) Pyridoxal kinase PdxY

SCOPe Domain Sequences for d5tqia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tqia1 c.72.1.0 (A:1-286) automated matches {Burkholderia multivorans [TaxId: 395019]}
mknvlsiqshviyghagnsaavfpmqrlgvnvwplntvqlsnhmqyghwagsaidaakme
qlvdgiaaigalkrcdavlsgfagspaqaratveivravkamnpnawyfcdpamgqtggi
rpepgveefivnempaladgmspnhtelqklagrrietvaeavdacrtliargpkiilvk
hlhdrnspadrfnmlavteteawigqrplyafprhpvgvgdltsaifvarrlrgdsvraa
fehtlaavhavvkatydarryeleliaaqdeiarpsewfgawvtdv

SCOPe Domain Coordinates for d5tqia1:

Click to download the PDB-style file with coordinates for d5tqia1.
(The format of our PDB-style files is described here.)

Timeline for d5tqia1:

  • d5tqia1 appears in periodic updates to SCOPe 2.06 starting on 2016-11-17

View in 3D
Domains from same chain:
(mouse over for more information)
d5tqia2