Lineage for d5eica_ (5eic A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993780Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1993781Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1993782Family a.29.2.1: Bromodomain [47371] (5 proteins)
  6. 1993817Protein automated matches [190366] (2 species)
    not a true protein
  7. 1993818Species Human (Homo sapiens) [TaxId:9606] [187201] (61 PDB entries)
  8. 1993859Domain d5eica_: 5eic A: [326335]
    Other proteins in same PDB: d5eicb2
    automated match to d4nyva_
    complexed with 5j5, edo

Details for d5eica_

PDB Entry: 5eic (more details), 1.5 Å

PDB Description: crystal structure of the bromodomain of human crebbp in complex with ayc
PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d5eica_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5eica_ a.29.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkld
tgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl

SCOPe Domain Coordinates for d5eica_:

Click to download the PDB-style file with coordinates for d5eica_.
(The format of our PDB-style files is described here.)

Timeline for d5eica_: