Lineage for d5tr9b1 (5tr9 B:14-114)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2402482Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2403031Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2403245Family b.43.4.0: automated matches [227162] (1 protein)
    not a true family
  6. 2403246Protein automated matches [226870] (22 species)
    not a true protein
  7. 2403327Species Neisseria gonorrhoeae [TaxId:1351790] [324310] (2 PDB entries)
  8. 2403330Domain d5tr9b1: 5tr9 B:14-114 [326090]
    Other proteins in same PDB: d5tr9a2, d5tr9b2
    automated match to d3fpka1
    complexed with cl, edo, fad, mg, na

Details for d5tr9b1

PDB Entry: 5tr9 (more details), 1.65 Å

PDB Description: crystal structure of a ferredoxin nadp+ reductase from neisseria gonorrhoeae with bound fad
PDB Compounds: (B:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d5tr9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tr9b1 b.43.4.0 (B:14-114) automated matches {Neisseria gonorrhoeae [TaxId: 1351790]}
eakfteekilwvkhhtpklitfaisrpesyrfkagqfsrlgfyegkgfiwraysvvsaey
adtleyfavliqdgpmsalfakmqqgdtilldknatgfllp

SCOPe Domain Coordinates for d5tr9b1:

Click to download the PDB-style file with coordinates for d5tr9b1.
(The format of our PDB-style files is described here.)

Timeline for d5tr9b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5tr9b2