Lineage for d3fpka1 (3fpk A:2-100)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2402482Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2403031Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2403245Family b.43.4.0: automated matches [227162] (1 protein)
    not a true family
  6. 2403246Protein automated matches [226870] (22 species)
    not a true protein
  7. 2403366Species Salmonella typhimurium [TaxId:99287] [225604] (1 PDB entry)
  8. 2403367Domain d3fpka1: 3fpk A:2-100 [210040]
    Other proteins in same PDB: d3fpka2, d3fpkb2
    automated match to d1fdra1
    complexed with ca, fad, mg

Details for d3fpka1

PDB Entry: 3fpk (more details), 1.7 Å

PDB Description: Crystal Structure of Ferredoxin-NADP Reductase from Salmonella typhimurium
PDB Compounds: (A:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d3fpka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fpka1 b.43.4.0 (A:2-100) automated matches {Salmonella typhimurium [TaxId: 99287]}
adwvtgkvtkvqnwtdalfsltvhapinpftagqftklgleidgervqraysyvnapdnp
nlefylvtvpqgklsprlaalkpgdevqvvsdasgffvl

SCOPe Domain Coordinates for d3fpka1:

Click to download the PDB-style file with coordinates for d3fpka1.
(The format of our PDB-style files is described here.)

Timeline for d3fpka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fpka2