Lineage for d5l66t_ (5l66 T:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228665Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2229596Domain d5l66t_: 5l66 T: [326063]
    Other proteins in same PDB: d5l66a_, d5l66c_, d5l66d_, d5l66e_, d5l66g_, d5l66i_, d5l66j_, d5l66k_, d5l66l_, d5l66n_, d5l66o_, d5l66q_, d5l66r_, d5l66s_, d5l66u_, d5l66w_, d5l66x_, d5l66y_, d5l66z_
    automated match to d4g4sg_
    complexed with bo2, cl, mg

Details for d5l66t_

PDB Entry: 5l66 (more details), 2.8 Å

PDB Description: yeast 20s proteasome with mouse beta5i (1-138) and mouse beta6 (97- 111; 118-133) in complex with bortezomib
PDB Compounds: (T:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d5l66t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l66t_ d.153.1.4 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

SCOPe Domain Coordinates for d5l66t_:

Click to download the PDB-style file with coordinates for d5l66t_.
(The format of our PDB-style files is described here.)

Timeline for d5l66t_: