Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein Proteasome alpha subunit (non-catalytic) [56255] (8 species) contains an extension to the common fold at the N-terminus |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256264] (12 PDB entries) |
Domain d5l5dq_: 5l5d Q: [325502] Other proteins in same PDB: d5l5da_, d5l5de_, d5l5dh_, d5l5di_, d5l5dj_, d5l5dm_, d5l5dn_, d5l5do_, d5l5ds_, d5l5dv_, d5l5dw_, d5l5dx_ automated match to d1iruf_ complexed with 04c, cl, mes, mg |
PDB Entry: 5l5d (more details), 2.8 Å
SCOPe Domain Sequences for d5l5dq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l5dq_ d.153.1.4 (Q:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
Timeline for d5l5dq_: