![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
![]() | Protein automated matches [190144] (11 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries) |
![]() | Domain d5l5iv_: 5l5i V: [325295] Other proteins in same PDB: d5l5ia_, d5l5ib_, d5l5ic_, d5l5id_, d5l5if_, d5l5ig_, d5l5ii_, d5l5ij_, d5l5ik_, d5l5il_, d5l5io_, d5l5ip_, d5l5iq_, d5l5ir_, d5l5it_, d5l5iu_, d5l5iw_, d5l5ix_, d5l5iy_, d5l5iz_ automated match to d4r17h_ complexed with 38x, cl, mes, mg |
PDB Entry: 5l5i (more details), 2.9 Å
SCOPe Domain Sequences for d5l5iv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l5iv_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee
Timeline for d5l5iv_: