Lineage for d5l5iv_ (5l5i V:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228665Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2229796Domain d5l5iv_: 5l5i V: [325295]
    Other proteins in same PDB: d5l5ia_, d5l5ib_, d5l5ic_, d5l5id_, d5l5if_, d5l5ig_, d5l5ii_, d5l5ij_, d5l5ik_, d5l5il_, d5l5io_, d5l5ip_, d5l5iq_, d5l5ir_, d5l5it_, d5l5iu_, d5l5iw_, d5l5ix_, d5l5iy_, d5l5iz_
    automated match to d4r17h_
    complexed with 38x, cl, mes, mg

Details for d5l5iv_

PDB Entry: 5l5i (more details), 2.9 Å

PDB Description: yeast 20s proteasome with human beta5i (1-138) and human beta6 (97- 111; 118-133) in complex with epoxyketone inhibitor 9
PDB Compounds: (V:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d5l5iv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l5iv_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee

SCOPe Domain Coordinates for d5l5iv_:

Click to download the PDB-style file with coordinates for d5l5iv_.
(The format of our PDB-style files is described here.)

Timeline for d5l5iv_: