Lineage for d5l55t_ (5l55 T:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2594884Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
    contains an extension to the common fold at the N-terminus
  7. 2596886Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256264] (12 PDB entries)
  8. 2596981Domain d5l55t_: 5l55 T: [325024]
    Other proteins in same PDB: d5l55a_, d5l55h_, d5l55i_, d5l55j_, d5l55k_, d5l55l_, d5l55m_, d5l55n_, d5l55o_, d5l55v_, d5l55w_, d5l55x_, d5l55y_, d5l55z_
    automated match to d4g4sg_
    complexed with 6nv, cl, mes, mg

Details for d5l55t_

PDB Entry: 5l55 (more details), 2.9 Å

PDB Description: yeast 20s proteasome in complex with epoxyketone inhibitor 18
PDB Compounds: (T:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d5l55t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l55t_ d.153.1.4 (T:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

SCOPe Domain Coordinates for d5l55t_:

Click to download the PDB-style file with coordinates for d5l55t_.
(The format of our PDB-style files is described here.)

Timeline for d5l55t_: