SCOPe 2.03: Domain d1a1va1: 1a1v A:190-325

Lineage for d1a1va1 (1a1v A:190-325)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.14: RNA helicase [52724] (4 proteins)
   duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension

6. Protein HCV helicase domain [52725] (1 species)

7. Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [52726] (16 PDB entries)

8. Domain d1a1va1: 1a1v A:190-325 [32467]
   protein/DNA complex; protein/RNA complex; complexed with so4

Details for d1a1va1

PDB Entry: 1a1v, 2.2 Å

PDB Description: hepatitis c virus ns3 helicase domain complexed with single stranded sdna

PDB Compounds: (A:) protein (ns3 protein)

SCOPe Domain Sequences for d1a1va1:

Sequence; same for both SEQRES and ATOM records:

>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}
ppavpqsfqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskahgvd
pnirtgvrtittgspitystygkfladggcsggaydiiicdechstdatsilgigtvldq
aetagarlvvlatatp

Timeline for d1a1va1:

• d1a1va1 first appeared (with stable ids) in SCOP 1.55
  
• d1a1va1 appears in SCOPe 2.02
  
• d1a1va1 appears in SCOPe 2.04
  
• d1a1va1 appears in the current release, SCOPe 2.08