Lineage for d5t48a1 (5t48 A:69-248)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204134Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. 2204135Superfamily d.86.1: eIF4e-like [55418] (3 families) (S)
  5. 2204224Family d.86.1.0: automated matches [191459] (1 protein)
    not a true family
  6. 2204225Protein automated matches [190708] (8 species)
    not a true protein
  7. 2204239Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [256194] (8 PDB entries)
  8. 2204247Domain d5t48a1: 5t48 A:69-248 [324551]
    Other proteins in same PDB: d5t48a2
    automated match to d1ipca_
    complexed with mgp

Details for d5t48a1

PDB Entry: 5t48 (more details), 2.19 Å

PDB Description: crystal structure of the d. melanogaster eif4e-eif4g complex without lateral contact
PDB Compounds: (A:) eukaryotic translation initiation factor 4e

SCOPe Domain Sequences for d5t48a1:

Sequence, based on SEQRES records: (download)

>d5t48a1 d.86.1.0 (A:69-248) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
khplmnvwtlwylendrskswedmqneitsfdtvedfwslynhikppseiklgsdyslfk
knirpmwedaankqggrwvitlnkssktdldnlwldvllcligeafdhsdqicgavinir
gksnkisiwtadgnneeaaleighklrdalrlgrnnslqyqlhkdtmvkqgsnvksiytl

Sequence, based on observed residues (ATOM records): (download)

>d5t48a1 d.86.1.0 (A:69-248) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
khplmnvwtlwylendrskswedmqneitsfdtvedfwslynhikppseiklgsdyslfk
knirpmwedaankqggrwvitlnkssktdldnlwldvllcligeafdhsdqicgavinir
gksnkisiwtadgnneeaaleighklrdalrlgrnnslqyqlhkdtmvkqnvksiytl

SCOPe Domain Coordinates for d5t48a1:

Click to download the PDB-style file with coordinates for d5t48a1.
(The format of our PDB-style files is described here.)

Timeline for d5t48a1: