Lineage for d5kqga_ (5kqg A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130626Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2130627Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) (S)
    share the common active site structure with the family II
  5. 2130628Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 proteins)
    automatically mapped to Pfam PF01451
  6. 2130652Protein Tyrosine phosphatase [52790] (5 species)
  7. 2130671Species Human (Homo sapiens) [TaxId:9606] [52792] (10 PDB entries)
  8. 2130676Domain d5kqga_: 5kqg A: [324092]
    automated match to d5pnta_
    complexed with 6vx

Details for d5kqga_

PDB Entry: 5kqg (more details), 1.5 Å

PDB Description: co-crystal structure of lmw-ptp in complex with 2-(benzothiazol-2- ylamino)-2-oxo-1-phenylethanesulfonic acid
PDB Compounds: (A:) Low molecular weight phosphotyrosine protein phosphatase

SCOPe Domain Sequences for d5kqga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kqga_ c.44.1.1 (A:) Tyrosine phosphatase {Human (Homo sapiens) [TaxId: 9606]}
atksvlfvclgnicrspiaeavfrklvtdqnisenwrvdsaatsgyeignppdyrgqscm
krhgipmshvarqitkedfatfdyilcmdesnlrdlnrksnqvktckakiellgsydpqk
qliiedpyygndsdfetvyqqcvrccraflekah

SCOPe Domain Coordinates for d5kqga_:

Click to download the PDB-style file with coordinates for d5kqga_.
(The format of our PDB-style files is described here.)

Timeline for d5kqga_: