SCOPe 2.06: Domain d5gqoa_: 5gqo A:

Lineage for d5gqoa_ (5gqo A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (33 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [323894] (1 PDB entry)

8. Domain d5gqoa_: 5gqo A: [324011]
   automated match to d1ue6b_
   complexed with ca

Details for d5gqoa_

PDB Entry: 5gqo, 2.5 Å

PDB Description: structure of the second single stranded dna binding protein (ssbb) from mycobacterium smegmatis

PDB Compounds: (A:) Single-stranded DNA-binding protein

SCOPe Domain Sequences for d5gqoa_:

Sequence, based on SEQRES records:

>d5gqoa_ b.40.4.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
etpftvvgniitnpvrlrfgdqelykfrvasnsrrrspegtwepgnslyvtvncwgnlar
gvsaslgkgdsvvvvghlytneyedregvrrssvevratavgpdlsrciarvekvqp

Sequence, based on observed residues (ATOM records):

>d5gqoa_ b.40.4.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
etpftvvgniitnpvrlrfgdqelykfrvasnslyvtvncwgnlargvsaslgkgdsvvv
vghlytneyerssvevratavgpdlsrciarvekvqp

Timeline for d5gqoa_:

• d5gqoa_ is new in SCOPe 2.06-stable
  
• d5gqoa_ appears in SCOPe 2.07
  
• d5gqoa_ appears in the current release, SCOPe 2.08