Class a: All alpha proteins [46456] (289 folds) |
Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily) multihelical |
Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families) duplication: contains two structural repeats |
Family a.86.1.0: automated matches [254307] (1 protein) not a true family |
Protein automated matches [254708] (2 species) not a true protein |
Species Bacillus megaterium [TaxId:1404] [255981] (18 PDB entries) |
Domain d5i3ab_: 5i3a B: [323943] automated match to d4p6ra_ complexed with hqe, zn |
PDB Entry: 5i3a (more details), 2.2 Å
SCOPe Domain Sequences for d5i3ab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i3ab_ a.86.1.0 (B:) automated matches {Bacillus megaterium [TaxId: 1404]} kyrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaahmss aflpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnpikd fivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtppwd mtsqnsfrnqlegfingpqlhnrvhrwvggqmgvvptapndpvfflhhanvdriwavwqi ihrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydiel
Timeline for d5i3ab_: