SCOPe 2.06: Domain d5i3ba_: 5i3b A:

Lineage for d5i3ba_ (5i3b A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
   multihelical

4. Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families)
   duplication: contains two structural repeats

5. Family a.86.1.0: automated matches [254307] (1 protein)
   not a true family

6. Protein automated matches [254708] (2 species)
   not a true protein

7. Species Bacillus megaterium [TaxId:1404] [255981] (18 PDB entries)

8. Domain d5i3ba_: 5i3b A: [323915]
   automated match to d4p6ra_
   complexed with hqe, zn

Details for d5i3ba_

PDB Entry: 5i3b, 2.2 Å

PDB Description: crystal structure of tyrosinase from bacillus megaterium with configuration b of hydroquinone inhibitor in the active site

PDB Compounds: (A:) tyrosinase

SCOPe Domain Sequences for d5i3ba_:

Sequence; same for both SEQRES and ATOM records:

>d5i3ba_ a.86.1.0 (A:) automated matches {Bacillus megaterium [TaxId: 1404]}
kyrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaahmss
aflpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnpikd
fivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtppwd
mtsqnsfrnqlegfingpqlhnrvhrwvggqmgvvptapndpvfflhhanvdriwavwqi
ihrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydiel

Timeline for d5i3ba_:

• d5i3ba_ is new in SCOPe 2.06-stable
  
• d5i3ba_ appears in SCOPe 2.07
  
• d5i3ba_ appears in the current release, SCOPe 2.08