Lineage for d5teab_ (5tea B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2060658Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2060659Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins)
    barrel, closed; n=5, S=8
  6. 2060750Protein automated matches [191079] (4 species)
    not a true protein
  7. 2060760Species Neisseria gonorrhoeae [TaxId:485] [323754] (1 PDB entry)
  8. 2060762Domain d5teab_: 5tea B: [323768]
    automated match to d3r5vd_
    complexed with ca, cl

Details for d5teab_

PDB Entry: 5tea (more details), 1.85 Å

PDB Description: crystal structure of an inorganic pyrophosphatase from neisseria gonorrhoeae
PDB Compounds: (B:) inorganic pyrophosphatase

SCOPe Domain Sequences for d5teab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5teab_ b.40.5.1 (B:) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
dfnqiltpgdvdggiinvvneipagsnhkiewnrklaafqldriepaifakptnygfipq
tldedgdeldvllvteqplatgvflearvigvmkfvddgevddkivcvpaddrnngnayk
tlsdlpqqlikqiefhfnhykdlkkagttkveswggaeeakkvikesierwnkq

SCOPe Domain Coordinates for d5teab_:

Click to download the PDB-style file with coordinates for d5teab_.
(The format of our PDB-style files is described here.)

Timeline for d5teab_: