Class b: All beta proteins [48724] (177 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) |
Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins) barrel, closed; n=5, S=8 |
Protein automated matches [191079] (4 species) not a true protein |
Species Neisseria gonorrhoeae [TaxId:485] [323754] (1 PDB entry) |
Domain d5teab_: 5tea B: [323768] automated match to d3r5vd_ complexed with ca, cl |
PDB Entry: 5tea (more details), 1.85 Å
SCOPe Domain Sequences for d5teab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5teab_ b.40.5.1 (B:) automated matches {Neisseria gonorrhoeae [TaxId: 485]} dfnqiltpgdvdggiinvvneipagsnhkiewnrklaafqldriepaifakptnygfipq tldedgdeldvllvteqplatgvflearvigvmkfvddgevddkivcvpaddrnngnayk tlsdlpqqlikqiefhfnhykdlkkagttkveswggaeeakkvikesierwnkq
Timeline for d5teab_: