Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
Protein automated matches [190531] (20 species) not a true protein |
Species Palmaria palmata [TaxId:2822] [323523] (1 PDB entry) |
Domain d5b13a_: 5b13 A: [323731] automated match to d1eyxa_ complexed with cyc, pub |
PDB Entry: 5b13 (more details), 2.09 Å
SCOPe Domain Sequences for d5b13a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b13a_ a.1.1.3 (A:) automated matches {Palmaria palmata [TaxId: 2822]} mksvmtttisaadaagrfpsssdlesvqgniqraaarleaaeklasnheavvkeggdacf akysylknpgeagdsqekvnkcyrdvdhymrlvnyslvvggtgpldewaiagarevyrtl nlpsasyvaafaftrdrlcvprdmsaqaggeyvaaldyivnalt
Timeline for d5b13a_: