Lineage for d5j17a_ (5j17 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2540226Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2540227Protein automated matches [190233] (31 species)
    not a true protein
  7. 2540283Species Human (Homo sapiens) [TaxId:9606] [187090] (152 PDB entries)
  8. 2540498Domain d5j17a_: 5j17 A: [323642]
    automated match to d1rfaa_

Details for d5j17a_

PDB Entry: 5j17 (more details)

PDB Description: solution structure of ras binding domain (rbd) of b-raf
PDB Compounds: (A:) Serine/threonine-protein kinase B-raf

SCOPe Domain Sequences for d5j17a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j17a_ d.15.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spqkpivrvflpnkqrtvvparcgvtvrdslkkalmmrglipeccavyriqdgekkpigw
dtdiswltgeelhvevlenv

SCOPe Domain Coordinates for d5j17a_:

Click to download the PDB-style file with coordinates for d5j17a_.
(The format of our PDB-style files is described here.)

Timeline for d5j17a_: